IFN omega 1 Recombinant Protein

Der Lieferant: Gentaur

0
( 0 Überprüfung )

€ Preis anfragen

Ask for price

Katalognummer: 223-91-864

Größe: 0.05 mg

IFN omega 1 Recombinant Protein
IFN omega 1 Recombinant Protein

Katalognummer: / Größe: / Preis: EUR (Excluded VAT)

Inquiry cart
1
Benutzer-E-Mail: | Edit
2
Informationen anfordern
IFN omega 1 Recombinant Protein
IFN omega 1 Recombinant Protein

Katalognummer: / Größe: / Preis: EUR (Excluding VAT)

3
Inquiry cart
Interferon omega-1 is also known as Interferon alpha-II-1and IFNW1. It is a Secreted protein that in humans is encoded by the IFNW1 gene. IFNW1 belongs to the alpha/beta interferon family. Type I IFNs consist of IFN alpha, beta , τ, and ω and bind to the type I IFN receptor, whereas IFN- gamma is the only type II IFN and is specific for the type II IFN receptor. IFNW1 is a recently discovered protein structurally related to IFN-alpha and –beta. It has been shown that IFN-omega 1 similar to that of other human class I IFNs; potent antiviral activity was also observed on cells of bovine and ovine but not of equine or murine origin.
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 21.1 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl, pH 7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: IFNW1
  • Accession #: P05000
  • Protein GI: 767957252
  • NCBI gene ID#: 3467
  • NCBI official full name: interferon, omega 1
  • NCBI organism: Homo sapiens
  • Peptide sequence: LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSSVDHHHHHH
  • SWISSPROT #: P05000
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Human
  • By Source: Human Cells
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Leu22-Ser195
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

0 Bewertungen für dieses Produkt

Bewertung hinzufügen

Deine Email-Adresse wird nicht veröffentlicht. Erforderliche Felder sind markiert *

1 2 3 4 5

Ausgewählte Produkte

Main Menu