Recombinant Human Neutrophil defensin 3 (DEFA3)

Der Lieferant: Gentaur

0
( 0 Überprüfung )

€ Preis anfragen

Größe: 10ug
Ask for price

Größe: 50ug
Ask for price

Größe: 100ug
Ask for price

Größe: 200ug
Ask for price

Größe: 500ug
Ask for price

Größe: 1MG
Ask for price

Katalognummer: 399-1-CSB-YP006655HU

Recombinant Human Neutrophil defensin 3 (DEFA3)
Recombinant Human Neutrophil defensin 3 (DEFA3)

Catalog number: / Size: / Price: (Excluded VAT)

Go to cart Go to order
Inquiry cart
1
Benutzer-E-Mail: | Edit
2
Informationen anfordern
Recombinant Human Neutrophil defensin 3 (DEFA3)
Recombinant Human Neutrophil defensin 3 (DEFA3)

Catalog number: / Size: / Price: (Excluding VAT)

3
Inquiry cart
39-94aa
N-terminal 6xHis-tagged
DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
For research use only.

0 Bewertungen für dieses Produkt

Bewertung hinzufügen

Deine Email-Adresse wird nicht veröffentlicht. Erforderliche Felder sind markiert *

1 2 3 4 5

Ausgewählte Produkte

AccuCount Blank, 10^6/mL, 5.0-5.9µm, 10mL
AccuCount Blank, 10^6/mL, 5.0-5.9µm, 10mL Kat. Nr.:ACBP-50-10
(0 rezensionen) (0)
NATtrol Pneumonia Panel-Atypical Bacteria & Viruses (12 x 0.2mL, 2 x 1.2 mL)
NATtrol Pneumonia Panel-Atypical Bacteria & Viruses (12 x 0.2mL, 2 x 1.2 mL) Kat. Nr.:NATPPA-BIO
(0 rezensionen) (0)
Carboxyl Polystyrene Particles, 5%w/v, 5.0-5.9µm, 10mL
Carboxyl Polystyrene Particles, 5%w/v, 5.0-5.9µm, 10mL Kat. Nr.:CP-50-10
(0 rezensionen) (0)
FITC Polystyrene Particles, 0.1%w/v, 2.0-2.9µm, 2mL
FITC Polystyrene Particles, 0.1%w/v, 2.0-2.9µm, 2mL Kat. Nr.:F1CP-20-2
(0 rezensionen) (0)
NATtrol Herpes Simplex Virus Type 2 Strain: MS (50,000 cp/mL) (1 mL)
NATtrol Herpes Simplex Virus Type 2 Strain: MS (50,000 cp/mL) (1 mL) Kat. Nr.:NATHSV2-0005
(0 rezensionen) (0)
AccuCount Fluorescent Particles, 10^6/mL, 5.0-5.9µm, 5mL
AccuCount Fluorescent Particles, 10^6/mL, 5.0-5.9µm, 5mL Kat. Nr.:ACFP-50-5
(0 rezensionen) (0)
Carboxyl Fluorescent Particles, Yellow, 0.5%w/v, 5.0-5.9µm, 2mL
Carboxyl Fluorescent Particles, Yellow, 0.5%w/v, 5.0-5.9µm, 2mL Kat. Nr.:CFP-5052-2
(0 rezensionen) (0)
Diogenes Kit
Diogenes Kit Kat. Nr.:NAT1000
(0 rezensionen) (0)
NATtrol Pneumonia Panel-Quantifiable Bacteria (17 x 0.2 mL, 3 x 1.2 mL)
NATtrol Pneumonia Panel-Quantifiable Bacteria (17 x 0.2 mL, 3 x 1.2 mL) Kat. Nr.:NATPPQ-BIO
(0 rezensionen) (0)
Total Glutathione Peroxidase Assay Kit (100 tests)
Total Glutathione Peroxidase Assay Kit (100 tests) Kat. Nr.:0805002
(0 rezensionen) (0)
NATtrol Clostridium difficile Negative Control (6 X 0.5 mL)
NATtrol Clostridium difficile Negative Control (6 X 0.5 mL) Kat. Nr.:NATCSO-6MC-IVD
(0 rezensionen) (0)
AccuCount Blank, 10^6/mL, 8.0-12.9µm, 10mL
AccuCount Blank, 10^6/mL, 8.0-12.9µm, 10mL Kat. Nr.:ACBP-100-10
(0 rezensionen) (0)
Rotavirus Rapid Test Control Pack (2 X 1.5mL)
Rotavirus Rapid Test Control Pack (2 X 1.5mL) Kat. Nr.:KZMC036
(0 rezensionen) (0)
Monkey Cardiac Troponin T ELISA kit
Monkey Cardiac Troponin T ELISA kit Kat. Nr.:E09T0017-96
(0 rezensionen) (0)
Mouse calnexin ELISA kit
Mouse calnexin ELISA kit Kat. Nr.:E03C1351-96
(0 rezensionen) (0)
Cookies
Wir verwenden Cookies. Wenn Sie damit einverstanden sind, klicken Sie einfach auf „Alle akzeptieren“. Sie können auch auswählen, welche Art von Cookies Sie möchten, indem Sie auf „Einstellungen“ klicken.
Einstellungen Alle akzeptieren
Cookies
Wählen Sie aus, welche Art von Cookies Sie akzeptieren möchten. Ihre Auswahl wird für ein Jahr gespeichert.
Speichern Alle akzeptieren

Main Menu