Recombinant Mycobacterium bovis Alpha-crystallin (hspX)

Der Lieferant: Gentaur

0
( 0 Überprüfung )

€ Preis anfragen

Größe: 10ug
Ask for price

Größe: 50ug
Ask for price

Größe: 100ug
Ask for price

Größe: 200ug
Ask for price

Größe: 500ug
Ask for price

Größe: 1MG
Ask for price

Katalognummer: 399-1-CSB-BP358651MVH

Recombinant Mycobacterium bovis Alpha-crystallin (hspX)
Recombinant Mycobacterium bovis Alpha-crystallin (hspX)

Katalognummer: / Größe: / Preis: (Excluded VAT)

Weiter einkaufen Angebot anfordern
Inquiry cart
1
Benutzer-E-Mail: | Edit
2
Informationen anfordern
Recombinant Mycobacterium bovis Alpha-crystallin (hspX)
Recombinant Mycobacterium bovis Alpha-crystallin (hspX)

Katalognummer: / Größe: / Preis: (Excluding VAT)

3
Inquiry cart
2-144aa
C-terminal 9xHis-tagged
ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
For research use only.

0 Bewertungen für dieses Produkt

Bewertung hinzufügen

Deine Email-Adresse wird nicht veröffentlicht. Erforderliche Felder sind markiert *

1 2 3 4 5

Ausgewählte Produkte

Fluorescent Particles, Nile Red, 1%w/v, 0.04-0.06µm, 2mL
Fluorescent Particles, Nile Red, 1%w/v, 0.04-0.06µm, 2mL Kat. Nr.:FP-00556-2
(0 rezensionen) (0)
NATtrol Herpes Simplex Virus Type 2 Strain: MS (50,000 cp/mL) (1 mL)
NATtrol Herpes Simplex Virus Type 2 Strain: MS (50,000 cp/mL) (1 mL) Kat. Nr.:NATHSV2-0005
(0 rezensionen) (0)
NATtrol MERS-CoV Stock (Qualitative) (1 mL)
NATtrol MERS-CoV Stock (Qualitative) (1 mL) Kat. Nr.:NATMERS-ST
(0 rezensionen) (0)
NATtrol Respiratory Pathogen Panel -1 (6 x 0.25 mL)
NATtrol Respiratory Pathogen Panel -1 (6 x 0.25 mL) Kat. Nr.:NATRPP-1
(0 rezensionen) (0)
Carboxyl Fluorescent Particles, Yellow, 1%w/v, 0.04-0.08µm, 2mL
Carboxyl Fluorescent Particles, Yellow, 1%w/v, 0.04-0.08µm, 2mL Kat. Nr.:CFP-00552-2
(0 rezensionen) (0)
Simian Immunodeficiency Virus (SIV) p27 Antigen ELISA (96 Determinations)
Simian Immunodeficiency Virus (SIV) p27 Antigen ELISA (96 Determinations) Kat. Nr.:0801169
(0 rezensionen) (0)
NATtrol Chlamydia trachomatis Positive Control (6 X 1 mL)
NATtrol Chlamydia trachomatis Positive Control (6 X 1 mL) Kat. Nr.:NATCT(434)-6MC
(0 rezensionen) (0)
Carboxyl Fluorescent Particles, Yellow, 1%w/v, 1.7-2.2µm, 2mL
Carboxyl Fluorescent Particles, Yellow, 1%w/v, 1.7-2.2µm, 2mL Kat. Nr.:CFP-2052-2
(0 rezensionen) (0)
NATtrol Mycoplasma pneumoniae M129, External Run Control, Low (6 X 1 mL)
NATtrol Mycoplasma pneumoniae M129, External Run Control, Low (6 X 1 mL) Kat. Nr.:NATMPN(M129)-ERCL
(0 rezensionen) (0)
Human Leukocyte antigen A ELISA kit
Human Leukocyte antigen A ELISA kit Kat. Nr.:E01H1252-96
(0 rezensionen) (0)
NATtrol GI Controls (12 x 0.2 mL)
NATtrol GI Controls (12 x 0.2 mL) Kat. Nr.:NATGIC-BIO
(0 rezensionen) (0)
NATtrol SARS-Related Coronavirus 2 (SARS-CoV-2) Stock
NATtrol SARS-Related Coronavirus 2 (SARS-CoV-2) Stock Kat. Nr.:NATSARS(COV2)-ST
(0 rezensionen) (0)
NATtrol Strep A Positive Control (6 x 0.5mL)
NATtrol Strep A Positive Control (6 x 0.5mL) Kat. Nr.:NATSPY-6MC
(0 rezensionen) (0)
NATtrol Norovirus GI/GII Positive Control (6 X 0.5 mL)
NATtrol Norovirus GI/GII Positive Control (6 X 0.5 mL) Kat. Nr.:MDZ049
(0 rezensionen) (0)
Carboxyl Magnetic Particles, 2.5%w/v, 6.0-8.0µm, 10mL
Carboxyl Magnetic Particles, 2.5%w/v, 6.0-8.0µm, 10mL Kat. Nr.:CM-60-10
(0 rezensionen) (0)
Cookies
Wir verwenden Cookies. Wenn Sie damit einverstanden sind, klicken Sie einfach auf „Alle akzeptieren“. Sie können auch auswählen, welche Art von Cookies Sie möchten, indem Sie auf „Einstellungen“ klicken.
Einstellungen Alle akzeptieren
Cookies
Wählen Sie aus, welche Art von Cookies Sie akzeptieren möchten. Ihre Auswahl wird für ein Jahr gespeichert.
Speichern Alle akzeptieren

Main Menu