Protein FAM3D Recombinant Protein

Der Lieferant: Gentaur

0
( 0 Überprüfung )

€ Preis anfragen

Ask for price

Katalognummer: 223-91-318

Größe: 0.05 mg

Kategorie: Wirtschaft & Industrie > Wissenschaft & Labor

Protein FAM3D Recombinant Protein
Protein FAM3D Recombinant Protein

Katalognummer: / Größe: / Preis: EUR (Excluded VAT)

Inquiry cart
1
Benutzer-E-Mail: | Edit
2
Informationen anfordern
Protein FAM3D Recombinant Protein
Protein FAM3D Recombinant Protein

Katalognummer: / Größe: / Preis: EUR (Excluding VAT)

3
Inquiry cart
Protein FAM3D is a novel cytokine-like protein that belongs to the FAM3 family. Human FAM3D is synthesized as a 224 amino acid precursor that contains a 25 amino acid signal sequence and a 199 amino acid mature chain. FAM3D is identified based on structural, but not sequence, homology to short chain cytokines including IL-2, IL-4 and GM-CSF. FAM3 proteins are four helix bundle cytokines with four conserved cysteines in all members (FAM3A-D). FAM3B is highly expressed in alpha and beta cells of the pancreas and is being investigated as a potential contributor to beta cell death and development of Type I Diabetes.
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 23.12 kD
  • Physical state: Liquid
  • Buffer: Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
  • Concentration: N/A
  • NCBI official symbol: FAM3D
  • Accession #: Q96BQ1
  • Protein GI: N/A
  • NCBI gene ID#: 131177
  • NCBI official full name: family with sequence similarity 3 member D
  • NCBI organism: Homo sapiens
  • Peptide sequence: YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPFVDHHHHHH
  • SWISSPROT #: Q96BQ1
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Human
  • By Source: Human Cells
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Tyr26-Phe224
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

0 Bewertungen für dieses Produkt

Bewertung hinzufügen

Deine Email-Adresse wird nicht veröffentlicht. Erforderliche Felder sind markiert *

1 2 3 4 5

Ausgewählte Produkte

Main Menu