Myelin Protein P0 Recombinant Protein
€ Preis anfragen //= __('Ask for price', \GentaurWPMain\Includes\Gentaur::PLUGIN_ID) ?> //= $prices ?>
Ask for price
Myelin Protein P0 (MPZ) is a single-pass type I membrane glycoprotein which belongs to the myelin P0 protein family. MPZ contains one Ig-like V-type (immunoglobulin-like) domain, absent in the central nervous system. MPZ is a major component of the myelin sheath in peripheral nerves. It is postulated that MPZ is a structural element in the formation and stabilisation of peripheral nerve myelin, holding its characteristic coil structure together by the interaction of its positively-charged domain with acidic lipids in the cytoplasmic face of the opposed bilayer, and by interaction between hydrophobic globular of adjacent extracellular domains. Defects in MPZ associated with Charcot-Marie-Tooth disease and Dejerine-Sottas disease.
- Tested Applications: N/A
- Applications: This recombinant protein can be used for biological assays. For research use only.
- Predicted Molecular Weight: 15.2 kD
- Physical state: Lyophilized
- Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl,pH7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
- Concentration: N/A
- NCBI official symbol: MPZ
- Accession #: P25189
- Protein GI: N/A
- NCBI gene ID#: 4359
- NCBI official full name: myelin protein zero
- NCBI organism: Homo sapiens
- Peptide sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRVDHHHHHH
- SWISSPROT #: P25189
- Background Reference 1: N/A
- Background Reference 2: N/A
- Background Reference 3: N/A
- Background Reference 4: N/A
- Background Reference 5: N/A
- Source: Human Cells
- Species: Human
- By Source: Human Cells
- By Species: Human
- Fusion tag: C-6 His tag
- Sequence: Ile30-Arg153
- Biology activity: N/A
- Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.