Recombinant Rickettsia rickettsii Protein p34 (p34), partial

Der Lieferant: Gentaur

0
( 0 Überprüfung )

€ Preis anfragen

Ask for price

Katalognummer: 399-CSB-EP321981RNC1-100ug

Größe: 100ug

Kategorie: Wirtschaft & Industrie > Wissenschaft & Labor

Recombinant Rickettsia rickettsii Protein p34 (p34), partial
Recombinant Rickettsia rickettsii Protein p34 (p34), partial

Catalog number: / Size: / Price: EUR (Excluded VAT)

Go to cart Go to order
Inquiry cart
1
Benutzer-E-Mail: | Edit
2
Informationen anfordern
Recombinant Rickettsia rickettsii Protein p34 (p34), partial
Recombinant Rickettsia rickettsii Protein p34 (p34), partial

Catalog number: / Size: / Price: EUR (Excluding VAT)

3
Inquiry cart
192-301aa
N-terminal 10xHis-tagged and C-terminal Myc-tagged
HSSYSLFKKAFKNLVDHELPEQDRQKIISIVNNHLGAKGMHEMKTRYAGQKAFIQCHLEMDGNMSLYNAHKISDEIAFEILQEFPEAEIIIHQDPFGIEEHVKYREYIVR

0 Bewertungen für dieses Produkt

Bewertung hinzufügen

Deine Email-Adresse wird nicht veröffentlicht. Erforderliche Felder sind markiert *

1 2 3 4 5

Ausgewählte Produkte

AccuCount Ultra Rainbow Fluorescent Particles, 10^6/mL, 3.8 (+/- 0.3)µm, 5mL
AccuCount Ultra Rainbow Fluorescent Particles, 10^6/mL, 3.8 (+/- 0.3)µm, 5mL Kat. Nr.:ACURFP-38-5
(0 rezensionen) (0)
HIV Seroconversion Panel Donor# 73698 (13 X 1 mL)
HIV Seroconversion Panel Donor# 73698 (13 X 1 mL) Kat. Nr.:HIV12008
(0 rezensionen) (0)
NATtrol Meningitis/Encephalitis Panel (14 x 0.4 mL)
NATtrol Meningitis/Encephalitis Panel (14 x 0.4 mL) Kat. Nr.:NATMEP-BIO
(0 rezensionen) (0)
HIV 1/2 Rapid Test Verification Panel (10 X 0.25 mL)
HIV 1/2 Rapid Test Verification Panel (10 X 0.25 mL) Kat. Nr.:KZMC029
(0 rezensionen) (0)
Simian Immunodeficiency Virus (SIV) p27 Antigen ELISA (5 X 96 Determinations)
Simian Immunodeficiency Virus (SIV) p27 Antigen ELISA (5 X 96 Determinations) Kat. Nr.:0801201
(0 rezensionen) (0)
Blank Calibration Particles, 5x10^6/mL, 8.0-12.9µm, 5mL
Blank Calibration Particles, 5x10^6/mL, 8.0-12.9µm, 5mL Kat. Nr.:BCP-100-5
(0 rezensionen) (0)
OptiClear
OptiClear Kat. Nr.:NAT1462
(0 rezensionen) (0)
HBV Seroconversion Panel Donor# 65556 (6 X 1 mL)
HBV Seroconversion Panel Donor# 65556 (6 X 1 mL) Kat. Nr.:HBV11002
(0 rezensionen) (0)
Dog Syndecan 1/CD138 ELISA kit
Dog Syndecan 1/CD138 ELISA kit Kat. Nr.:E08S0301-96
(0 rezensionen) (0)
Glutathione Reductase Assay Kit (100 tests)
Glutathione Reductase Assay Kit (100 tests) Kat. Nr.:0805004
(0 rezensionen) (0)
Fluorescent Particles, Nile Red, 1%w/v, 2.5-3.6µm, 2mL
Fluorescent Particles, Nile Red, 1%w/v, 2.5-3.6µm, 2mL Kat. Nr.:FP-3056-2
(0 rezensionen) (0)
NATtrol Norovirus GI/GII Positive Control (6 X 0.5 mL)
NATtrol Norovirus GI/GII Positive Control (6 X 0.5 mL) Kat. Nr.:NATNOV-6MC-IVD
(0 rezensionen) (0)
NATtrol Vaginal Panel (24 x 0.5 mL)
NATtrol Vaginal Panel (24 x 0.5 mL) Kat. Nr.:NATVP-BD
(0 rezensionen) (0)
Anti-Digoxigenin Coated Polystyrene Particles, 0.4- 0.6µm, 0.1%w/v, 2mL
Anti-Digoxigenin Coated Polystyrene Particles, 0.4- 0.6µm, 0.1%w/v, 2mL Kat. Nr.:DIGP-05-2
(0 rezensionen) (0)
Mouse calnexin ELISA kit
Mouse calnexin ELISA kit Kat. Nr.:E03C1351-96
(0 rezensionen) (0)
Cookies
Wir verwenden Cookies. Wenn Sie damit einverstanden sind, klicken Sie einfach auf „Alle akzeptieren“. Sie können auch auswählen, welche Art von Cookies Sie möchten, indem Sie auf „Einstellungen“ klicken.
Einstellungen Alle akzeptieren
Cookies
Wählen Sie aus, welche Art von Cookies Sie akzeptieren möchten. Ihre Auswahl wird für ein Jahr gespeichert.
Speichern Alle akzeptieren

Main Menu