Recombinant Human Parathyroid hormone protein (PTH), partial (Active)

Der Lieferant: Gentaur

0
( 0 Überprüfung )

€ Preis anfragen

Ask for price

Katalognummer: 399-CSB-AP000021HU-each

Größe: each

Recombinant Human Parathyroid hormone protein (PTH), partial (Active)
Recombinant Human Parathyroid hormone protein (PTH), partial (Active)

Catalog number: / Size: / Price: EUR (Excluded VAT)

Go to cart Go to order
Inquiry cart
1
Benutzer-E-Mail: | Edit
2
Informationen anfordern
Recombinant Human Parathyroid hormone protein (PTH), partial (Active)
Recombinant Human Parathyroid hormone protein (PTH), partial (Active)

Catalog number: / Size: / Price: EUR (Excluding VAT)

3
Inquiry cart
32-65aa
Tag-Free
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

0 Bewertungen für dieses Produkt

Bewertung hinzufügen

Deine Email-Adresse wird nicht veröffentlicht. Erforderliche Felder sind markiert *

1 2 3 4 5

Ausgewählte Produkte

100ML Hydromount
100ML Hydromount Kat. Nr.:NAT1324
(0 rezensionen) (0)
1L SequaGel UreaGel-6
1L SequaGel UreaGel-6 Kat. Nr.:NAT1146
(0 rezensionen) (0)
NATtrol Influenza/RSV Negative Control (6 X 0.5 mL)
NATtrol Influenza/RSV Negative Control (6 X 0.5 mL) Kat. Nr.:NATCXVA9-6C-IVD
(0 rezensionen) (0)
Fluorescent Particles, Nile Red, 1%w/v, 0.04-0.06µm, 2mL
Fluorescent Particles, Nile Red, 1%w/v, 0.04-0.06µm, 2mL Kat. Nr.:FP-00556-2
(0 rezensionen) (0)
Total Glutathione Peroxidase Assay Kit (100 tests)
Total Glutathione Peroxidase Assay Kit (100 tests) Kat. Nr.:0805002
(0 rezensionen) (0)
NATtrol EV Positive Control (6 X 0.2 mL)
NATtrol EV Positive Control (6 X 0.2 mL) Kat. Nr.:NATEVPOS-6MC
(0 rezensionen) (0)
NATtrol GI Controls (12 x 0.2 mL)
NATtrol GI Controls (12 x 0.2 mL) Kat. Nr.:NATGIC-BIO
(0 rezensionen) (0)
NATtrol Neisseria gonorrhoeae Positive Control Pack (6 X 1.25 mL)
NATtrol Neisseria gonorrhoeae Positive Control Pack (6 X 1.25 mL) Kat. Nr.:NATNG-6MC-IVD
(0 rezensionen) (0)
EasyComp Fluorescent Particles Kit, 5 vials (Blank, FITC, PE, PE-Cy5 & APC)
EasyComp Fluorescent Particles Kit, 5 vials (Blank, FITC, PE, PE-Cy5 & APC) Kat. Nr.:ECFP-K2
(0 rezensionen) (0)
NATtrol Strep A Positive Control (6 x 0.5mL)
NATtrol Strep A Positive Control (6 x 0.5mL) Kat. Nr.:NATSPY-6MC
(0 rezensionen) (0)
NATtrol GBS Negative Control (6 X 0.5 mL)
NATtrol GBS Negative Control (6 X 0.5 mL) Kat. Nr.:NATLAC-6MC-IVD
(0 rezensionen) (0)
NATtrol Neisseria gonorrhoeae Positive Control (6 X 1 mL)
NATtrol Neisseria gonorrhoeae Positive Control (6 X 1 mL) Kat. Nr.:NATNG-6MC
(0 rezensionen) (0)
NATtrol Meningitis/Encephalitis (ME) Controls (12 x 0.2 mL)
NATtrol Meningitis/Encephalitis (ME) Controls (12 x 0.2 mL) Kat. Nr.:NATMEC-BIO
(0 rezensionen) (0)
NATtrol BV Negative Control (6 X 0.15mL)
NATtrol BV Negative Control (6 X 0.15mL) Kat. Nr.:NATBVNEG-BD
(0 rezensionen) (0)
Cookies
Wir verwenden Cookies. Wenn Sie damit einverstanden sind, klicken Sie einfach auf „Alle akzeptieren“. Sie können auch auswählen, welche Art von Cookies Sie möchten, indem Sie auf „Einstellungen“ klicken.
Einstellungen Alle akzeptieren
Cookies
Wählen Sie aus, welche Art von Cookies Sie akzeptieren möchten. Ihre Auswahl wird für ein Jahr gespeichert.
Speichern Alle akzeptieren

Main Menu