Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY), Biotinylated

Der Lieferant: Gentaur

0
( 0 Überprüfung )

€ Preis anfragen

Ask for price

Katalognummer: 399-CSB-EP366179EDZg10-B-20ug

Größe: 20ug

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY), Biotinylated
Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY), Biotinylated

Catalog number: / Size: / Price: EUR (Excluded VAT)

Go to cart Go to order
Inquiry cart
1
Benutzer-E-Mail: | Edit
2
Informationen anfordern
Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY), Biotinylated
Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY), Biotinylated

Catalog number: / Size: / Price: EUR (Excluding VAT)

3
Inquiry cart
1-137aa
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

0 Bewertungen für dieses Produkt

Bewertung hinzufügen

Deine Email-Adresse wird nicht veröffentlicht. Erforderliche Felder sind markiert *

1 2 3 4 5

Ausgewählte Produkte

NATtrol Influenza A H3 Virus Stock (Qualitative) (1 mL)
NATtrol Influenza A H3 Virus Stock (Qualitative) (1 mL) Kat. Nr.:NATFLUAH3-ST
(0 rezensionen) (0)
NATtrol Influenza/RSV Negative Control (6 x 0.5mL)
NATtrol Influenza/RSV Negative Control (6 x 0.5mL) Kat. Nr.:NATCXVA9-6C
(0 rezensionen) (0)
Pig Secretoglobin, Family 1A, Member 1 (Uteroglobin) (SCGB1A1) ELISA kit
Pig Secretoglobin, Family 1A, Member 1 (Uteroglobin) (SCGB1A1) ELISA kit Kat. Nr.:E07U0019-96
(0 rezensionen) (0)
NATtrol Norovirus GI/GII Positive Control (6 X 0.5 mL)
NATtrol Norovirus GI/GII Positive Control (6 X 0.5 mL) Kat. Nr.:MDZ049
(0 rezensionen) (0)
NATtrol Clostridium difficile Negative Control (6 X 0.5 mL)
NATtrol Clostridium difficile Negative Control (6 X 0.5 mL) Kat. Nr.:NATCSO-6MC-IVD
(0 rezensionen) (0)
Carboxyl Magnetic Blue Particle Array Kit, 6 Peaks, 1E7/mL, 4.0-4.9µm, 6x1mL
Carboxyl Magnetic Blue Particle Array Kit, 6 Peaks, 1E7/mL, 4.0-4.9µm, 6x1mL Kat. Nr.:CMPAK-4068-6K
(0 rezensionen) (0)
1L SequaGel UreaGel-6
1L SequaGel UreaGel-6 Kat. Nr.:NAT1146
(0 rezensionen) (0)
Anti-Digoxigenin Coated Polystyrene Particles, 2.0- 2.4µm, 0.1%w/v, 2mL
Anti-Digoxigenin Coated Polystyrene Particles, 2.0- 2.4µm, 0.1%w/v, 2mL Kat. Nr.:DIGP-20-2
(0 rezensionen) (0)
AccuCount UltraRainbow Calibration Particles, 25.0µm(+/-2µm), 2.5x10^6/mL, 1mL
AccuCount UltraRainbow Calibration Particles, 25.0µm(+/-2µm), 2.5x10^6/mL, 1mL Kat. Nr.:ACURFP2.5-250-1
(0 rezensionen) (0)
25ML TEMED
25ML TEMED Kat. Nr.:NAT1060
(0 rezensionen) (0)
NATtrol Respiratory Pathogen Panel -1 (6 x 0.25 mL)
NATtrol Respiratory Pathogen Panel -1 (6 x 0.25 mL) Kat. Nr.:NATRPP-1
(0 rezensionen) (0)
HTLV p19 Antigen ELISA (96 Determinations)
HTLV p19 Antigen ELISA (96 Determinations) Kat. Nr.:0801116
(0 rezensionen) (0)
NATtrol Cytomegalovirus (CMV) Strain:AD-169 External Run Control, Medium (6X1mL)
NATtrol Cytomegalovirus (CMV) Strain:AD-169 External Run Control, Medium (6X1mL) Kat. Nr.:NATCMV-ERCM
(0 rezensionen) (0)
OptiClear
OptiClear Kat. Nr.:NAT1460
(0 rezensionen) (0)
NATtrol EV Panel (20 X 0.2 mL)
NATtrol EV Panel (20 X 0.2 mL) Kat. Nr.:NATEVP-C
(0 rezensionen) (0)
Cookies
Wir verwenden Cookies. Wenn Sie damit einverstanden sind, klicken Sie einfach auf „Alle akzeptieren“. Sie können auch auswählen, welche Art von Cookies Sie möchten, indem Sie auf „Einstellungen“ klicken.
Einstellungen Alle akzeptieren
Cookies
Wählen Sie aus, welche Art von Cookies Sie akzeptieren möchten. Ihre Auswahl wird für ein Jahr gespeichert.
Speichern Alle akzeptieren

Main Menu